Proteintech, 33114-1-AP, CPTP Polyclonal antibody

Size: 20ul / 150ul The CPTP (33114-1-AP) by Proteintech is a Polyclonal antibody targeting CPTP in WB, ELISA applications with reactivity to human samples 33114-1-AP targets CPTP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Ceramide-1-phosphate transfer protein (CPTP) is a member of the glycolipid transfer protein (GLTP) family. It is the only identified protein in mammals that can selectively transport ceramide-1-phosphate (C1P) through a non-vesicular mechanism (PMID: 35982909). CPTP plays a crucial role in various biological processes, including cell proliferation, migration, and invasion. It is involved in the regulation of lipid metabolism, particularly in the context of ceramide-1-phosphate, which is a bioactive sphingolipid with roles in cell signaling, inflammation, and autophagy (PMID: 29164996). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35748 Product name: Recombinant human GLTPD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of NM_001029885 Sequence: MDDSETGFNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSKLRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQLFLEGLRTSPEDARTSALCADSYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVYNVSQKLYAEHSLLDLP Predict reactive species Full Name: glycolipid transfer protein domain containing 1 Calculated Molecular Weight: 24 kDa，214aa Observed Molecular Weight: 24 kDa GenBank Accession Number: NM_001029885 Gene Symbol: GLTPD1 Gene ID (NCBI): 80772 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5TA50 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.