Proteintech, 33188-1-AP, MFAP3L Polyclonal antibody

Size: 20ul / 150ul The MFAP3L (33188-1-AP) by Proteintech is a Polyclonal antibody targeting MFAP3L in WB, ELISA applications with reactivity to human, mouse samples 33188-1-AP targets MFAP3L in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Microfibrillar-associated protein 3-like (MFAP3L) is a member of the microfibril-associated glycoprotein (MAGP) family. MFAP3L exhibits strong expression in the testis. It functions as a dual-specificity kinase, phosphorylating tyrosine and threonine on target proteins. MFAP3L is involved in the nuclear signaling of EGFR and ERK2, playing a role in cell invasion and metastasis in colorectal cancer (PMID: 24735981). It may also participate in the regulation of tumor microenvironment status and molecular subtypes in bladder cancer (PMID: 39489826). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37478 Product name: Recombinant human MFAP3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-149 aa of NM_021647.7 Sequence: KSVTNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDM Predict reactive species Full Name: microfibrillar-associated protein 3-like Calculated Molecular Weight: 45 kDa，409aa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_021647.7 Gene Symbol: MFAP3L Gene ID (NCBI): 9848 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75121 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.