Proteintech, 33194-1-AP, KCTD19 Polyclonal antibody

Size: 20ul / 150ul The KCTD19 (33194-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD19 in WB, ELISA applications with reactivity to human, mouse, rat samples 33194-1-AP targets KCTD19 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36660 Product name: Recombinant human KCTD19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_001100915.3 Sequence: MEESGMAHESAEDLFHFNVGGWHFSVPRSKLSQFPDSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNLLYEQALGLQLMPLLQTLDNLKEGKHHLRVRPADLPVAERASLNYWRTWKCISKPSEFPIKSPAFT Predict reactive species Full Name: potassium channel tetramerisation domain containing 19 Calculated Molecular Weight: 105 kDa，926aa Observed Molecular Weight: 105 kDa GenBank Accession Number: NM_001100915.3 Gene Symbol: KCTD19 Gene ID (NCBI): 146212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q17RG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.