Iright
BRAND / VENDOR: Proteintech

Proteintech, 33203-1-AP, TMEM209 Polyclonal antibody

CATALOG NUMBER: 33203-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM209 (33203-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM209 in WB, ELISA applications with reactivity to human, mouse, rat samples 33203-1-AP targets TMEM209 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, Jurkat cells, human testis tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Transmembrane protein 209 (TMEM209) is a nuclear envelope protein that interacts with nucleoporin protein NUP205, and may be involved in nuclear transport of various nuclear proteins in addition to MYC (PMID: 22719065). Additionally, TMEM209 is implicated in the regulation of the Wnt/β-catenin signaling pathway, which is often activated in hepatocellular carcinoma (HCC) and contributes to tumor progression (PMID: 39414762). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34162 Product name: Recombinant human TMEM209 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 210-362 aa of BC045618 Sequence: VESSGLRSRYRSSPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLGSPDSTSPSSSPTFWNYSRSMGDYAQTLKKFQYQLACRSQAPCANKDEADLSSKQAAEEVWARVAMNRQLLDHMDSWTAKFRNWINETILVPLVQEIESVSTQM Predict reactive species Full Name: transmembrane protein 209 Calculated Molecular Weight: 561 aa, 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC045618 Gene Symbol: TMEM209 Gene ID (NCBI): 84928 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96SK2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924