Iright
BRAND / VENDOR: Proteintech

Proteintech, 33205-1-AP, PRDM6 Polyclonal antibody

CATALOG NUMBER: 33205-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRDM6 (33205-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM6 in WB, ELISA applications with reactivity to human samples 33205-1-AP targets PRDM6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MCF-7 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PRDM6 is a poorly characterized member of the PRDF1 and RIZ1 homology domain-containing (PRDM) family of transcription factors that possess histone lysine methyltransferase activities through their catalytic SET domain. Based on findings in other species, PRDM6 is currently classified as a pseudo-methyltransferase that may interact with the methyltransferase G9a and corepressors to indirectly affect the methylation status of histone H3 lysine and histone H4 lysine. PRDM6 inhibition may have therapeutic value in PRDM6-expressing medulloblastomas (PMID: 38992221). PRDM6 has one glycosylation modification site. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38054 Product name: Recombinant human PRDM6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 380-595 aa of NM_001136239 Sequence: AQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSGPIESGFNQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQRILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITESPESIEVD Predict reactive species Full Name: PR domain containing 6 Calculated Molecular Weight: 595aa, 64 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: NM_001136239 Gene Symbol: PRDM6 Gene ID (NCBI): 93166 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NQX0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924