Iright
BRAND / VENDOR: Proteintech

Proteintech, 33230-1-AP, Cathepsin D Polyclonal antibody

CATALOG NUMBER: 33230-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Cathepsin D (33230-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin D in WB, ELISA applications with reactivity to mouse samples 33230-1-AP targets Cathepsin D in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: BV-2 cells, Neuro-2a cells, J774A.1 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CTSD (Cathepsin D) also named CPSD, is a representative aspartic proteinase in lysosomes and is widely distributed in various tissue cells of mammals. The expression level of CTSD varies depending on the tissue, whereas neurons in CNS tissues possess abundant CTSD. CTSD is synthesized as a 52-kDa precursor that is converted into an active ~48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 28-kDa heavy chain and a 14-kDa light chain, in the lysosomes (PMID: 10995834, PMID: 7641679, PMID: 30051532). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2986 Product name: Recombinant Mouse Cathepsin D protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-410 aa of NM_009983.3 Sequence: IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL Predict reactive species Full Name: cathepsin D Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 14 kDa ,28 kDa, 46~52 kDa GenBank Accession Number: NM_009983.3 Gene Symbol: Ctsd Gene ID (NCBI): 13033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P18242 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924