Iright
BRAND / VENDOR: Proteintech

Proteintech, 33233-1-AP, Ferritin heavy chain Polyclonal antibody

CATALOG NUMBER: 33233-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Ferritin heavy chain (33233-1-AP) by Proteintech is a Polyclonal antibody targeting Ferritin heavy chain in WB, IHC, ELISA applications with reactivity to mouse, rat samples 33233-1-AP targets Ferritin heavy chain in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: C6 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tissue Positive IHC detected in: mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Ferritin heavy chain(FTH1, ferritin, heavy polypeptide 1 ), as a 21 kDa subunit of the ferritin complex, exhibits ferroxidase activity, which serves an essential role in catalyzing the conversion of the ferrous ions (Fe2+) to the ferric form (Fe3+). FTH1 regulates angiogenesis during inflammation and malignancy by binding to high molecular weight kininogen (HKa) and blocking its anti-angiogenic activity on endothelial cells in vitro and in vivo(PMID: 33260500). FTH1 has been shown to protect proximal tube epithelial cells and kidneys against the activity of free iron in reactive oxygen species generation. FTH1 plays an important role in the maintenance of the cellular iron balance in ferroptosis. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg4765 Product name: Recombinant Mouse Ferritin heavy chain/FTH1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-182 aa of NM_010239.2 Sequence: MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLGHGDES Predict reactive species Full Name: ferritin heavy chain 1 Calculated Molecular Weight: 21kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: NM_010239.2 Gene Symbol: Fth1 Gene ID (NCBI): 14319 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P09528 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924