Proteintech, 33235-1-AP, DcTRAILR1/TNFRSF23 Polyclonal antibody

Size: 20ul / 150ul The DcTRAILR1/TNFRSF23 (33235-1-AP) by Proteintech is a Polyclonal antibody targeting DcTRAILR1/TNFRSF23 in WB, ELISA applications with reactivity to mouse, rat samples 33235-1-AP targets DcTRAILR1/TNFRSF23 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse thymus tissue, rat spleen tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Decoy TRAIL receptor 1 (DcTRAILR1), also known as tumor necrosis factor receptor superfamily member 23 (TNFRSF23), is a GPI-anchored mouse TNF receptor superfamily member that lacks a cytoplasmic death domain. It is a decoy TRAIL receptor that can block TRAIL-induced apoptosis (PMID: 12466268). It has been reported that upregulation of DcTRAILR1 can prolong the lifespan of tumor-associated neutrophils (PMID: 39558859; 38207030). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg5262 Product name: recombinant mouse DcTRAILR1/TNFRSF23 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 30-155 aa of NM_024290.4 Sequence: MPESYSFNCPDGEYQSNDVCCKTCPSGTFVKAPCKIPHTQGQCEKCHPGTFTGKDNGLHDCELCSTCDKDQNMVADCSATSDRKCECQIGLYYYDPKFPESCRPCTKCPQGIPVLQECNSTANTVC Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 23 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: NM_024290.4 Gene Symbol: Tnfrsf23 Gene ID (NCBI): 79201 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9ER63 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.