Iright
BRAND / VENDOR: Proteintech

Proteintech, 33253-1-AP, SMU1 Polyclonal antibody

CATALOG NUMBER: 33253-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMU1 (33253-1-AP) by Proteintech is a Polyclonal antibody targeting SMU1 in WB, ELISA applications with reactivity to human, mouse samples 33253-1-AP targets SMU1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The SMU1 gene, situated on human chromosome 9p21.1, is highly conserved across eukaryotic species and encodes a protein with a WD40 domain, placing it within the WD40-repeat protein family. SMU1 is involved in various cellular processes such as signal transduction, pre-mRNA processing, and cytoskeleton assembly modulation through its receptor/regulator module. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29580 Product name: Recombinant human SMU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-365 aa of BC002876 Sequence: DLFRGKAAVKDVEEEKFPTQLSRHIKFGQKSHVECARFSPDGQYLVTGSVDGFIEVWNFTTGKIRKDLKYQAQDNFMMMDDAVLCMCFSRDTEMLATGAQDGKIKVWKIQSGQCLRRFERAHSKGVTCLSFSKDSSQILSASFDQTIRIHGLKSGKTLKEFRGHSSFVNEATFTQDGHYII Predict reactive species Full Name: smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC002876 Gene Symbol: SMU1 Gene ID (NCBI): 55234 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q2TAY7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924