Iright
BRAND / VENDOR: Proteintech

Proteintech, 33284-1-AP, CD16/CD32 Polyclonal antibody

CATALOG NUMBER: 33284-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD16/CD32 (33284-1-AP) by Proteintech is a Polyclonal antibody targeting CD16/CD32 in WB, ELISA applications with reactivity to mouse samples 33284-1-AP targets CD16/CD32 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: J774A.1 cells, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CD16 (FcγRIII) is a 50-70 kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. This antibody was raised against the extracellular domain (30-210aa) of mouse CD32, which is over 95% homologous to that of mouse CD16. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg5259 Product name: Recombinant Mouse CD32B/Fcgr2b protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 30-210 aa of Sequence: THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLP Predict reactive species Full Name: Fc receptor, IgG, low affinity IIb Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 40-70 kDa Gene Symbol: CD16/32 Gene ID (NCBI): 14130 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P08101-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924