Proteintech, 33358-1-AP, GPR37L1 Polyclonal antibody

Size: 20ul / 150ul The GPR37L1 (33358-1-AP) by Proteintech is a Polyclonal antibody targeting GPR37L1 in WB, ELISA applications with reactivity to human, mouse, rat samples 33358-1-AP targets GPR37L1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information GPR37L1 (G Protein-Coupled Receptor 37 Like 1) is a protein that belongs to the large and diverse family of G protein-coupled receptors (GPCRs). GPCRs are crucial cellular sensors, spanning the cell membrane to transmit signals from the outside to the inside of the cell, governing virtually every physiological process. The apparent molecular weight is larger than the calculated molecular weight of 53 kDa, which is likely due to posttranslational modification, presumably by glycosylation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36603 Product name: Recombinant human GPR37L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-134 aa of NM_004767.3 Sequence: APLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSAYAIM Predict reactive species Full Name: G protein-coupled receptor 37 like 1 Calculated Molecular Weight: 53kDa，481aa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_004767.3 Gene Symbol: GPR37L1 Gene ID (NCBI): 9283 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O60883 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.