Proteintech, 33388-1-AP, Ig Lambda Constant 7 Polyclonal antibody

Size: 20ul / 150ul The Ig Lambda Constant 7 (33388-1-AP) by Proteintech is a Polyclonal antibody targeting Ig Lambda Constant 7 in WB, ELISA applications with reactivity to human samples 33388-1-AP targets Ig Lambda Constant 7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Background Information Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. This antibody is constant region of immunoglobulin light chains. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg4582 Product name: Recombinant Human IGLC7 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-106 aa of / Sequence: GQPKAAPSVTLFPPSSEELQANKATLVCLVSDFNPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS Predict reactive species Full Name: immunoglobulin lambda constant 7 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: / Gene Symbol: IGLC7 Gene ID (NCBI): 28834 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A0M8Q6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.