Proteintech, 33428-1-AP, REG Polyclonal antibody

Size: 20ul / 150ul The REG (33428-1-AP) by Proteintech is a Polyclonal antibody targeting REG in WB, ELISA applications with reactivity to mouse, rat samples 33428-1-AP targets REG in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. It's reported that REG1A was significantly upregulated in tumor specimens and adenoma as compared to normal colorectal tissue. (PMID: 34698109) Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg6797 Product name: Recombinant mouse Reg1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-165 aa of NM_009042.1 Sequence: QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG Predict reactive species Full Name: regenerating islet-derived 1 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: NM_009042.1 Gene Symbol: Reg1 Gene ID (NCBI): 19692 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P43137 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.