Iright
BRAND / VENDOR: Proteintech

Proteintech, 33429-1-AP, ORM2 Polyclonal antibody

CATALOG NUMBER: 33429-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ORM2 (33429-1-AP) by Proteintech is a Polyclonal antibody targeting ORM2 in WB, ELISA applications with reactivity to mouse samples 33429-1-AP targets ORM2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, PNGF treated mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg6796 Product name: Recombinant mouse Orm2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-207 aa of NM_011016.2 Sequence: QNPEHVNITIGDPITNETLSWLSDKWFFIGAAVLNPDYRQEIQKTQMVFFNLTPNLINDTMELREYHTIDDHCVYNSTHLGIQRENGTLSKYVGGVKIFADLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA Predict reactive species Full Name: orosomucoid 2 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24 kDa, 35-47 kDa GenBank Accession Number: NM_011016.2 Gene Symbol: Orm2 Gene ID (NCBI): 18406 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P07361 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924