Proteintech, 33447-1-AP, RPP25L Polyclonal antibody

Size: 20ul / 150ul The RPP25L (33447-1-AP) by Proteintech is a Polyclonal antibody targeting RPP25L in WB, ELISA applications with reactivity to human samples 33447-1-AP targets RPP25L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A-204 cells, A431 cells, BxPC-3 cells, DU 145 cells, Raji cells, Ramos cells, THP-1 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information RPP25L (Ribonuclease P protein subunit p25-like protein), also known as C9orf23. RPP25L is a subunit of RNase P complex, which is mainly involved in the processing of tRNA precursor, and is responsible for cutting off the 5' leading sequence of tRNA precursor to generate mature tRNA. In addition, RPP25L may also participate in other RNA metabolism processes, such as the processing of rRNA. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37795 Product name: Recombinant human C9orf23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC032136 Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS Predict reactive species Full Name: chromosome 9 open reading frame 23 Observed Molecular Weight: 17-19 kDa GenBank Accession Number: BC032136 Gene Symbol: C9orf23 Gene ID (NCBI): 138716 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N5L8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.