Proteintech, 33499-1-AP, GPR175 Polyclonal antibody

Size: 20ul / 150ul The GPR175 (33499-1-AP) by Proteintech is a Polyclonal antibody targeting GPR175 in WB, ELISA applications with reactivity to human samples 33499-1-AP targets GPR175 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information GPR175, also known as TPRA1 or TPRA40, is a transmembrane protein. GPR175 was first cloned as a GLP-1 receptor homolog in 3T3-L1 adipocytes and is also expressed in tissues that require Hh signaling during development, including the heart, brain, lung, pancreas, and muscle. Endogenous GPR175 localizes to cilia in a Hh-dependent manner, where it can interact with (constitutively) ciliary Gαi1 to inhibit the local production of cAMP by adenylyl cyclase. The calculated molecular weight of GPR175 is 41 kDa. With glycosylation modification, the molecular weight of GPR175 will be migrated to 55 kDa. (PMID: 26451044) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39379 Product name: Recombinant human GPR175 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 286-373 aa of BC050711 Sequence: SEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAINA Predict reactive species Full Name: G protein-coupled receptor 175 Observed Molecular Weight: 55 kDa GenBank Accession Number: BC050711 Gene Symbol: GPR175 Gene ID (NCBI): 131601 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86W33 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.