Iright
BRAND / VENDOR: Proteintech

Proteintech, 33510-1-AP, Angiopoietin 4 Polyclonal antibody

CATALOG NUMBER: 33510-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Angiopoietin 4 (33510-1-AP) by Proteintech is a Polyclonal antibody targeting Angiopoietin 4 in WB, ELISA applications with reactivity to human, mouse samples 33510-1-AP targets Angiopoietin 4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, NCI-H1299 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36152 Product name: Recombinant human ANGPT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-290 aa of BC111976 Sequence: TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQD Predict reactive species Full Name: angiopoietin 4 Observed Molecular Weight: 57 kDa GenBank Accession Number: BC111976 Gene Symbol: ANGPT4 Gene ID (NCBI): 51378 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y264 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924