Iright
BRAND / VENDOR: Proteintech

Proteintech, 33511-1-AP, TMEM256 Polyclonal antibody

CATALOG NUMBER: 33511-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM256 (33511-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM256 in WB, ELISA applications with reactivity to human samples 33511-1-AP targets TMEM256 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, LNCaP cells, U-251 cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TMEM256, also known as C17orf61, is a number of TMEM families, encodes a protein of ~11.7 kDa, TMEM256 is expressed in proximal renal tubular cells, and its subcellular localization is in exosomes (PMID: 39991002). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36789 Product name: Recombinant human C17orf61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-92 aa of BC030270 Sequence: AQFPDAYGKELFDKANKHHFLHSLALLGVPHCRKPLWAGLLLASGTTLFCTSFYYQALSGDPS Predict reactive species Full Name: chromosome 17 open reading frame 61 Observed Molecular Weight: 12 kDa GenBank Accession Number: BC030270 Gene Symbol: C17orf61 Gene ID (NCBI): 254863 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N2U0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924