Iright
BRAND / VENDOR: Proteintech

Proteintech, 33521-1-AP, GDF6/BMP-13 Polyclonal antibody

CATALOG NUMBER: 33521-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GDF6/BMP-13 (33521-1-AP) by Proteintech is a Polyclonal antibody targeting GDF6/BMP-13 in WB, ELISA applications with reactivity to human samples 33521-1-AP targets GDF6/BMP-13 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, SK-N-SH cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information GDF6, also known as BMP-13, is a member of the transforming growth factor-beta superfamily. GDF6 is a multifunctional growth factor that mainly functions in cells derived from the mesoderm. It can regulate the proliferation and differentiation of the retina and bones(PMID: 23307924). Mutations in GDF6 are associated with Klippel-Feil syndrome(PMID: 18425797). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40394 Product name: Recombinant human BMP-13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 336-455 aa of NM_001001557 Sequence: TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR Predict reactive species Full Name: growth differentiation factor 6 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: NM_001001557 Gene Symbol: GDF6 Gene ID (NCBI): 392255 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6KF10 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924