Iright
BRAND / VENDOR: Proteintech

Proteintech, 33571-1-AP, C9orf114 Polyclonal antibody

CATALOG NUMBER: 33571-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C9orf114 (33571-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf114 in WB, ELISA applications with reactivity to human samples 33571-1-AP targets C9orf114 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SPOUT1 (SPOUT domain-containing methyltransferase 1), also known as CENP32 or C9orf114, is a methyltransferase containing a SPOUT domain. This protein is highly expressed in the nucleolus and is crucial for ribosome function. SPOUT1 has been identified as an essential protein for cell survival in both Drosophila and humans. Moreover, mutations in SPOUT1 are associated with developmental epileptic encephalopathy (DEE) in humans, characterized by infantile seizures and intellectual disability. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38014 Product name: Recombinant human C9orf114 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-340 aa of BC063644 Sequence: HQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYV Predict reactive species Full Name: chromosome 9 open reading frame 114 Observed Molecular Weight: 40 kDa GenBank Accession Number: BC063644 Gene Symbol: C9orf114 Gene ID (NCBI): 51490 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5T280 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924