Iright
BRAND / VENDOR: Proteintech

Proteintech, 33583-1-AP, TBC1D8 Polyclonal antibody

CATALOG NUMBER: 33583-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TBC1D8 (33583-1-AP) by Proteintech is a Polyclonal antibody targeting TBC1D8 in WB, IHC, ELISA applications with reactivity to human samples 33583-1-AP targets TBC1D8 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The TBC1D8 protein is a member of the TBC domain family and functions as a GTPase-activating protein (GAP) that negatively regulates the activity of small G proteins of the Rab family, participating in the fine-tuning of intracellular vesicle transport and signal transduction. This protein has garnered significant attention in reproductive and cancer research. Studies have shown that TBC1D8 is a key determinant of oocyte maturation and female fertility, with defects in its expression leading to embryonic development arrest. Moreover, TBC1D8 is abnormally overexpressed in various cancers (such as breast and lung cancer), where it acts as an oncogene by modulating signaling pathways related to cell proliferation, invasion, and metastasis (e.g., the EGFR/Ras pathway). Thus, it serves as a potential biomarker for disease diagnosis and a therapeutic target. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35398 Product name: Recombinant human TBC1D8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 941-1140 aa of NM_001102426 Sequence: RNPLLSTSRPLVFGKPNGDAVDYQKQLKQMIKDLAKEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATVTTLLLQIGEVGQRGSSSGSCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSELKLSNL Predict reactive species Full Name: TBC1 domain family, member 8 (with GRAM domain) Calculated Molecular Weight: 130kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: NM_001102426 Gene Symbol: TBC1D8 Gene ID (NCBI): 11138 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O95759 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924