Proteintech, 33597-1-AP, CARS2 Polyclonal antibody

Size: 20ul / 150ul The CARS2 (33597-1-AP) by Proteintech is a Polyclonal antibody targeting CARS2 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 33597-1-AP targets CARS2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SK-BR-3 cells Positive IP detected in: SK-BR-3 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cars2 (mitochondrial cysteine-tRNA synthetase 2) is a class I aminoacyl-tRNA synthetase encoded by nuclear gene, which locates in mitochondria. Its core function is to catalyze cysteine to bind to corresponding trna, and ensure the translation of mitochondrial protein. Its mutation will cause diseases related to mitochondrial dysfunction. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38943 Product name: Recombinant human CARS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-564 aa of NM_024537.3 Sequence: FLKTFSPDVFRFFCLRSSYRSAIDYSDSAMLQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVVDAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQRTKDQKSAG Predict reactive species Full Name: cysteinyl-tRNA synthetase 2, mitochondrial (putative) Calculated Molecular Weight: 62kDa，564aa Observed Molecular Weight: 55-63kd GenBank Accession Number: NM_024537.3 Gene Symbol: CARS2 Gene ID (NCBI): 79587 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9HA77 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.