Iright
BRAND / VENDOR: Proteintech

Proteintech, 33606-1-AP, GLCE Polyclonal antibody

CATALOG NUMBER: 33606-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLCE (33606-1-AP) by Proteintech is a Polyclonal antibody targeting GLCE in WB, ELISA applications with reactivity to human, mouse, rat samples 33606-1-AP targets GLCE in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information GLCE encodes the C5-epimerase responsible for converting glucuronic acid to iduronic acid during heparan sulfate biosynthesis. Localized in the Golgi apparatus, it indirectly regulates growth factor signaling, angiogenesis, and cell-cell interactions through structural diversification of glycosaminoglycan chains. Dysregulation of GLCE has been associated with cancer progression and developmental abnormalities, highlighting its role at the interface of glycobiology and disease. (PMID: 24499487) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35424 Product name: Recombinant human GLCE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-200 aa of BC160046 Sequence: NKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLS Predict reactive species Full Name: glucuronic acid epimerase Observed Molecular Weight: 70 kDa GenBank Accession Number: BC160046 Gene Symbol: GLCE Gene ID (NCBI): 26035 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O94923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924