Iright
BRAND / VENDOR: Proteintech

Proteintech, 33756-1-AP, SERPINB1 Polyclonal antibody

CATALOG NUMBER: 33756-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SERPINB1 (33756-1-AP) by Proteintech is a Polyclonal antibody targeting SERPINB1 in WB, ELISA applications with reactivity to human samples 33756-1-AP targets SERPINB1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SERPINB1, also called Leukocyte Elastase Inhibitor (LEI) is a member of the clade B of SERPINS. It is an intracellular protein and acts primarily to protect the cell from proteases released into the cytoplasm during stress. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35798 Product name: Recombinant human SERPINB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 169-318 aa of NM_030666.3 Sequence: GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKI Predict reactive species Full Name: serpin peptidase inhibitor, clade B (ovalbumin), member 1 Calculated Molecular Weight: 43kDa,379aa Observed Molecular Weight: 42 kDa GenBank Accession Number: NM_030666.3 Gene Symbol: SERPINB1 Gene ID (NCBI): 1992 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P30740 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924