Iright
BRAND / VENDOR: Proteintech

Proteintech, 33819-1-AP, C10orf35 Polyclonal antibody

CATALOG NUMBER: 33819-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C10orf35 (33819-1-AP) by Proteintech is a Polyclonal antibody targeting C10orf35 in WB, ELISA applications with reactivity to human samples 33819-1-AP targets C10orf35 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MG-63 cells, U-251 cells, U2OS cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36807 Product name: Recombinant human C10orf35 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-91 aa of BC013587 Sequence: MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTS Predict reactive species Full Name: chromosome 10 open reading frame 35 Observed Molecular Weight: 15 kDa GenBank Accession Number: BC013587 Gene Symbol: C10orf35 Gene ID (NCBI): 219738 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96D05 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924