Proteintech, 33836-1-AP, MAGEL2 Polyclonal antibody

Size: 20ul / 150ul The MAGEL2 (33836-1-AP) by Proteintech is a Polyclonal antibody targeting MAGEL2 in IHC, ELISA applications with reactivity to human, mouse samples 33836-1-AP targets MAGEL2 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39140 Product name: Recombinant human MAGEL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of NM_019066.4 Sequence: MSQLSKNLGDSSPPAEAPKPPVYSRPTVLMRAPPASSRAPPVPWDPPPIDLQASLAAWQAPQPAWEAPQGQLPAPVVPMTQPPALGGPIVPAPPLGGPMGKPPTPGVLMVHPPPPGAPMAQPPTPGVLMV Predict reactive species Full Name: MAGE-like 2 Calculated Molecular Weight: 133kDa，1249aa GenBank Accession Number: NM_019066.4 Gene Symbol: MAGEL2 Gene ID (NCBI): 54551 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UJ55 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.