Iright
BRAND / VENDOR: Proteintech

Proteintech, 33841-1-AP, HFM1 Polyclonal antibody

CATALOG NUMBER: 33841-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HFM1 (33841-1-AP) by Proteintech is a Polyclonal antibody targeting HFM1 in WB, ELISA applications with reactivity to human samples 33841-1-AP targets HFM1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells, MDA-MB-231 cells, human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information HFM1 (helicase for meiosis 1), also known as MER3, POF9, Si-11, SEC63D1, and Si-11-6, is a candidate gene of POI. HFM1 was reported to be mainly expressed in germline cells, which is required for crossover formation and complete synapsis of homologous chromosomes in spermiogenesis HFM1, expressed specifically in germline tissues, is a typical ATP-dependent DNA helicase mediating meiosis (PMID: 39725823, 37020390). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40875 Product name: Recombinant human HFM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 333-518 aa of BC130525 Sequence: LPKYELKVEQITRYSDTTAEILVTVILRNFEQLQTKRTASDSHYVTLIIGDADNQVVYLHKITDSVLLKAGSWAKKIAVKRALKSEDLSINLISSEFVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCKSKHTCGHDCCKIGVAQKSEIKE Predict reactive species Full Name: HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae) Observed Molecular Weight: 63-70 kDa GenBank Accession Number: BC130525 Gene Symbol: HFM1 Gene ID (NCBI): 164045 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A2PYH4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924