Iright
BRAND / VENDOR: Proteintech

Proteintech, 33845-1-AP, RAP2C Polyclonal antibody

CATALOG NUMBER: 33845-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAP2C (33845-1-AP) by Proteintech is a Polyclonal antibody targeting RAP2C in WB, ELISA applications with reactivity to human samples 33845-1-AP targets RAP2C in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, MCF-7 cells, SW480 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information RAP2C is a member of the Ras superfamily, which is the promoter of tumorigenesis. RAP2C plays a key role in the migration and invasion of various tumors, such as osteosarcoma, glioma, and small cell lung cancer (SCLC).(PMID: 29552178; PMID: 32341653; PMID: 33302819) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38723 Product name: Recombinant human RAP2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC003403 Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALVQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ Predict reactive species Full Name: RAP2C, member of RAS oncogene family Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC003403 Gene Symbol: RAP2C Gene ID (NCBI): 57826 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y3L5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924