Iright
BRAND / VENDOR: Proteintech

Proteintech, 33895-1-AP, REG3G Polyclonal antibody

CATALOG NUMBER: 33895-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The REG3G (33895-1-AP) by Proteintech is a Polyclonal antibody targeting REG3G in WB, ELISA applications with reactivity to human, mouse samples 33895-1-AP targets REG3G in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information REG3G (Regenerating Islet-Derived 3 Gamma) is a small intestinal C-type lectin-like antimicrobial peptide mainly secreted by Paneth cells. First identified in regenerating pancreas, it is now recognized as a key defender of the gut barrier: it kills Gram-positive bacteria, limits bacterial contact with the epithelium, and thus helps prevent systemic inflammation and metabolic disease. Beyond its antimicrobial role, REG3G acts as a gut-derived hormone that links the intestinal microbiome to host metabolism. Its expression is boosted by dietary fiber, beneficial bacteria, interleukin-22 (IL-22) and bariatric surgery, and it reciprocally improves glucose control, reduces hepatic steatosis, accelerates wound healing and protects pancreatic β-cells by activating the JAK2/STAT3 pathway . Conversely, chronic alcohol intake or dysbiosis lowers REG3G levels, weakening the gut barrier and promoting alcoholic liver disease. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35686 Product name: Recombinant human REG3G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-175 aa of BC103854 Sequence: EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD Predict reactive species Full Name: regenerating islet-derived 3 gamma Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC103854 Gene Symbol: REG3G Gene ID (NCBI): 130120 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6UW15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924