Proteintech, 33909-1-AP, Sarcalumenin Polyclonal antibody

Size: 20ul / 150ul The Sarcalumenin (33909-1-AP) by Proteintech is a Polyclonal antibody targeting Sarcalumenin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 33909-1-AP targets Sarcalumenin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Sarcalumenin, also known as SAR, is a luminal Ca2+ buffer protein with high capacity but low affinity for calcium binding found predominantly in the longitudinal sarcoplasmic reticulum (SR) of fast and slow-twitch skeletal muscles and the heart. Together with other luminal Ca2+ buffer proteins, SAR plays a critical role in modulation of Ca2+ uptake and Ca2+ release during excitation-contraction coupling in muscle fibers. SAR appears to be important in a wide range of other physiological functions, such as stabilizing Sarco-Endoplasmic Reticulum Calcium ATPase (SERCA), regulating Store-Operated Calcium Entry (SOCE) mechanisms, enhancing muscle fatigue resistance, and promoting muscle development. The SAR has a molecular weight of 160 kDa (long isoform). Due to alternative splicing, the SAR gene also encodes a 53 kDa glycoprotein variant (short isoform), which shares the identical COOH-terminal half with SAR and lacks Ca²⁺-binding capacity (PMID: 19502553, PMID: 36899851). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40750 Product name: Recombinant human SRL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 399-473 aa of BC160181 Sequence: EAYKDFFGINPISSFKLLSQQCSYMGGCFLEKIERAITQELPGLLGSLGLGKNPGALNCDKTGCSETPKNRYRKH Predict reactive species Full Name: sarcalumenin Observed Molecular Weight: 53 kDa GenBank Accession Number: BC160181 Gene Symbol: SRL Gene ID (NCBI): 6345 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86TD4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.