Proteintech, 33935-1-AP, DBX1 Polyclonal antibody

Size: 20ul / 150ul The DBX1 (33935-1-AP) by Proteintech is a Polyclonal antibody targeting DBX1 in WB, ELISA applications with reactivity to human samples 33935-1-AP targets DBX1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information DBX1 (Homeobox protein DBX1) is a central nervous system (CNS)-specific transcription factor that plays crucial roles in embryonic brain development. It belongs to the H2.0 homeobox family and contains a DNA-binding homeodomain, which allows it to regulate gene expression by binding to specific DNA sequences. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40954 Product name: Recombinant human DBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-343 aa of NM_001029865 Sequence: ERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHLRDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS Predict reactive species Full Name: developing brain homeobox 1 Calculated Molecular Weight: 343aa, 37 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: NM_001029865 Gene Symbol: DBX1 Gene ID (NCBI): 120237 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6NMT0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.