Iright
BRAND / VENDOR: Proteintech

Proteintech, 33935-1-AP, DBX1 Polyclonal antibody

CATALOG NUMBER: 33935-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DBX1 (33935-1-AP) by Proteintech is a Polyclonal antibody targeting DBX1 in WB, ELISA applications with reactivity to human samples 33935-1-AP targets DBX1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information DBX1 (Homeobox protein DBX1) is a central nervous system (CNS)-specific transcription factor that plays crucial roles in embryonic brain development. It belongs to the H2.0 homeobox family and contains a DNA-binding homeodomain, which allows it to regulate gene expression by binding to specific DNA sequences. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40954 Product name: Recombinant human DBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-343 aa of NM_001029865 Sequence: ERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHLRDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS Predict reactive species Full Name: developing brain homeobox 1 Calculated Molecular Weight: 343aa, 37 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: NM_001029865 Gene Symbol: DBX1 Gene ID (NCBI): 120237 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A6NMT0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924