Iright
BRAND / VENDOR: Proteintech

Proteintech, 33953-1-AP, HDHD1A Polyclonal antibody

CATALOG NUMBER: 33953-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HDHD1A (33953-1-AP) by Proteintech is a Polyclonal antibody targeting HDHD1A in WB, ELISA applications with reactivity to human samples 33953-1-AP targets HDHD1A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Ramos cells, A549 cells, Caco-2 cells, Calu-1 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information The enzyme encoded by human HDHD1A (hHDHD1A; also known as HDHD1, PUDP, GS1; Gene ID: 8226) has activity specific for ΨMP 5'-phosphatase (PMID: 20722631). HDHD1A belongs to the HAD-like hydrolase superfamily. In humans, the enzyme HDHD1A dephosphorylates pseudouridine 5'-monophosphate (ΨMP), and the resulting Ψ is excreted in the urine (PMID: 40409548). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40679 Product name: Recombinant human HDHD1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC012494 Sequence: MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE Predict reactive species Full Name: haloacid dehalogenase-like hydrolase domain containing 1A Calculated Molecular Weight: 228 aa, 25 kDa GenBank Accession Number: BC012494 Gene Symbol: HDHD1A Gene ID (NCBI): 8226 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q08623 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924