Iright
BRAND / VENDOR: Proteintech

Proteintech, 33956-1-AP, ZAN Polyclonal antibody

CATALOG NUMBER: 33956-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZAN (33956-1-AP) by Proteintech is a Polyclonal antibody targeting ZAN in WB, IP, ELISA applications with reactivity to human, mouse samples 33956-1-AP targets ZAN in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ZAN (Zonadhesin) is a sperm-specific type-I transmembrane glycoprotein essential for species-restricted binding between spermatozoa and the egg's zona pellucida. First isolated from boar sperm, it is expressed solely in post-meiotic male germ cells (early spermatids) and localises to the apical segment of the sperm head. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35843 Product name: Recombinant human ZAN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-200 aa of NM_003386 Sequence: RKEKPPDQKLVVRSSRDNYVLTQCDFEDDAKPLCDWSQVSADDEDWVRASGPSPTGSTGAPGGYPNGEGSYLHMESNSFHRGGVARLLSPDLWEQGPLCVHFAHHMFGLSWGAQLRLLLLSGEEGRRPDVLWKHWNTQRPSWMLTTVTVPAGFTLPTRLMFEGTRGSTAYLDIALDALSIRRG Predict reactive species Full Name: zonadhesin Calculated Molecular Weight: 305kDa Observed Molecular Weight: 230 kDa GenBank Accession Number: NM_003386 Gene Symbol: ZAN Gene ID (NCBI): 7455 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y493 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924