Iright
BRAND / VENDOR: Proteintech

Proteintech, 33987-1-AP, FAM72A Polyclonal antibody

CATALOG NUMBER: 33987-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM72A (33987-1-AP) by Proteintech is a Polyclonal antibody targeting FAM72A in WB, ELISA applications with reactivity to human samples 33987-1-AP targets FAM72A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FAM72A, also named as LMIP and UGENE, is a mitochondrial protein which regulates cellular reactive oxygen species metabolism. It's up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. FAM72 has some members A/B/C/D with higher homology. This antibody detects all the members of FAM72. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag41693 Product name: Recombinant human FAM72A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 98-149 aa of BC035696 Sequence: NGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR Predict reactive species Full Name: family with sequence similarity 72, member A Calculated Molecular Weight: 149 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC035696 Gene Symbol: FAM72 Gene ID (NCBI): 729533 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5TYM5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924