Iright
BRAND / VENDOR: Proteintech

Proteintech, 33992-1-AP, TSKS Polyclonal antibody

CATALOG NUMBER: 33992-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSKS (33992-1-AP) by Proteintech is a Polyclonal antibody targeting TSKS in WB, ELISA applications with reactivity to human, mouse, rat samples 33992-1-AP targets TSKS in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Testis-specific serine kinase substrate (TSKS) was identified as a substrate for testis-specific serine kinase 1 (TSSK1) and TSSK2. Although these three proteins co-localize to nuage, double knockout (KO) mice lacking TSSK1 and TSSK2 (Tssk1/2 dKO mice) exhibit abnormal mitochondrial sheath formation, suggesting that these proteins and nuage are involved in mitochondrial sheath formation. However, the previous study observed abundant cytoplasm in the late spermatids at seminiferous tubule stage VIII of the Tssk1/2 dKO mouse. Furthermore, an interaction between TSKS and phosphatase protein PPP1CC2 was also reported previously. Protein phosphatase 1 catalytic subunit gamma (Ppp1cc) is a member of the PP1 family of protein phosphatases that encodes two splice isoforms: the ubiquitous Ppp1cc1 and the testis-specific Ppp1cc2. Ppp1cc knockout (KO) male mice also exhibit malformed mitochondrial sheath formation. These data indicate that the kinase and phosphatase of TSKS are involved in the formation of the mitochondrial sheath (PMID: 36881620). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38588 Product name: Recombinant human TSKS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 328-592 aa of NM_021733.1 Sequence: EELRREVSSLTARWHQEEGAVQEALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCARCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ Predict reactive species Full Name: testis-specific serine kinase substrate Calculated Molecular Weight: 65kDa,592aa Observed Molecular Weight: 65 kDa GenBank Accession Number: NM_021733.1 Gene Symbol: TSKS Gene ID (NCBI): 60385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UJT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924