Proteintech, 34046-1-AP, COA5 Polyclonal antibody

Size: 20ul / 150ul The COA5 (34046-1-AP) by Proteintech is a Polyclonal antibody targeting COA5 in WB, ELISA applications with reactivity to human samples 34046-1-AP targets COA5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The cytochrome c oxidase assembly factor 5 (COA5) gene, previously denoted as C2orf64, was first reported in humans when a homozygous missense variant (c.157G>C, p.Ala53Pro) in this gene was shown to cause mitochondrial disease. COA5 is a small mitochondrial protein required for an early step in the assembly of cytochrome-c oxidase (complex IV) of the respiratory chain. It contains a conserved twin-CX9C motif, is located in the mitochondrial inner membrane (PMID: 39779219). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag41138 Product name: Recombinant human COA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC047722 Sequence: MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY Predict reactive species Full Name: Cytochrome c oxidase assembly factor 5 Observed Molecular Weight: 8~12 kDa GenBank Accession Number: BC047722 Gene Symbol: C2orf64 Gene ID (NCBI): 493753 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86WW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.