Iright
BRAND / VENDOR: Proteintech

Proteintech, 34055-1-AP, COLEC12 Polyclonal antibody

CATALOG NUMBER: 34055-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COLEC12 (34055-1-AP) by Proteintech is a Polyclonal antibody targeting COLEC12 in WB, ELISA applications with reactivity to human, mouse samples 34055-1-AP targets COLEC12 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Colonin-12 (COLEC12), also known as colonin subfamily member 12 or CL-P1, is a pattern recognition receptor belonging to the colonin family. As a scavenger receptor, it plays a role in innate immunity, recognizing pathogen-associated molecular patterns (PAMPs) and damaged self-components. COLEC12 plays a role in pathogen clearance, apoptotic cell recognition, and the regulation of inflammatory responses. COLEC12 is also associated with cardiovascular disease and host defense mechanisms. (PMID: 10224141; 27377710;11564734; 24058540) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39696 Product name: Recombinant human COLEC12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-433 aa of BC060789 Sequence: QASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENITTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTLTSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVIMEEMKLVDSKHGQ Predict reactive species Full Name: collectin sub-family member 12 Calculated Molecular Weight: 82 kDa Observed Molecular Weight: 140 kDa, 90 kDa, 70 kDa, GenBank Accession Number: BC060789 Gene Symbol: COLEC12 Gene ID (NCBI): 81035 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5KU26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924