Iright
BRAND / VENDOR: Proteintech

Proteintech, 51006-2-AP, PTRH2 Polyclonal antibody

CATALOG NUMBER: 51006-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTRH2 (51006-2-AP) by Proteintech is a Polyclonal antibody targeting PTRH2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 51006-2-AP targets PTRH2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, Jurkat cells, MCF-7 cells, Raji cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PTRH2 (Peptidyl-tRNA Hydrolase 2, also known as Bcl-2 Inhibitor of Transcription 1 or BIT1) is a highly conserved protein that plays crucial roles in various cellular processes, including protein synthesis, cell survival, and cell death. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0839 Product name: Recombinant human PTRH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC006807 Sequence: MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY Predict reactive species Full Name: peptidyl-tRNA hydrolase 2 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC006807 Gene Symbol: PTRH2 Gene ID (NCBI): 51651 RRID: AB_2173280 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3E5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924