Proteintech, 51029-2-AP, SSTR5 Polyclonal antibody

Size: 20ul / 150ul The SSTR5 (51029-2-AP) by Proteintech is a Polyclonal antibody targeting SSTR5 in WB, ELISA applications with reactivity to human, mouse samples 51029-2-AP targets SSTR5 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0519 Product name: Recombinant human SSTR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC146576 Sequence: MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAG Predict reactive species Full Name: somatostatin receptor 5 Calculated Molecular Weight: 364 aa, 39 kDa Observed Molecular Weight: 50 kDa, 65 kDa GenBank Accession Number: BC146576 Gene Symbol: SSTR5 Gene ID (NCBI): 6755 RRID: AB_615039 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35346 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.