Proteintech, 60041-1-Ig, DSE Monoclonal antibody

Size: 20ul / 150ul The DSE (60041-1-Ig) by Proteintech is a Monoclonal antibody targeting DSE in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 60041-1-Ig targets DSE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information DSE, also named as SART2 and DSEPI, is an enzyme that converts D-glucuronic acid to L-iduronic acid residues in dermatan sulphate biosynthesis. It is also identified to be a tumour-associated antigen. DSE is recognized by cytotoxic T cells (CTLs) and its enhanced expression in many cancers has been reported. DSE is a potential candidate for a tumour antigen with immunogenicity. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0695 Product name: Recombinant human DSE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 659-958 aa of BC039245 Sequence: RAAYLFIGPSIDVQSFTVHGDSQQLDVFIATSKHAYATYLWTGEATGQSAFAQVIADRHKILFDRNSAIKSSIVPEVKDYAAIVEQNLQHFKPVFQLLEKQILSRVRNTASFRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYTRLFLILNIAIFFVMLAMQLTYFQRAQSLHGQRCLYAVLLIDSCILLWLYSSCSQSQC Predict reactive species Full Name: dermatan sulfate epimerase Calculated Molecular Weight: 958 aa, 110 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC039245 Gene Symbol: DSE Gene ID (NCBI): 29940 RRID: AB_2093286 Conjugate: Unconjugated Form: Liquid Purification Method: Caprylic Acid-Ammonium Sulfate Precipitation UNIPROT ID: Q9UL01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.