Proteintech, 60060-1-Ig, Follistatin Monoclonal antibody

Size: 20ul / 150ul The Follistatin (60060-1-Ig) by Proteintech is a Monoclonal antibody targeting Follistatin in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 60060-1-Ig targets Follistatin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Raji cells, U2OS cells, SKOV-3 cells, A549 cells, NCI-H1299 cells, Calu-3 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Follistatin (FST) is a member of the tissue growth factor β family and is a secreted glycoprotein that antagonizes many members of the family, including activin A, growth differentiation factor11 , and myostatin. It binds activin A with high affinity and whose expression can be induced by activin A and several other pro-inflammatory cytokines. Activin A-follistatin complexes are biologically inactive and bind to cell surface heparan sulphate-containing proteoglycans for internalisation and degradation. It has also been found to play a significant role in the management of skeletal muscle size and mass. It also has important roles in early embryonic development, differentiation of ovarian granulosa cells, liver fibrosis and polycystic ovarian syndrome. FS 288 glycosylation results in a major species of 35 kDa and a less abundant 40 kDa and minor products of 40 and 42 kDa (PMID: 9785474). Three typical follistatin bands are at 32, 35, and 39 kDa (PMID: 2036994). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, camel Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0775 Product name: Recombinant human FST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-344 aa of BC004107 Sequence: MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW Predict reactive species Full Name: follistatin Calculated Molecular Weight: 33 aa, 7 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC004107 Gene Symbol: Follistatin Gene ID (NCBI): 10468 RRID: AB_2106706 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P19883 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.