Iright
BRAND / VENDOR: Proteintech

Proteintech, 60062-1-Ig, GMF Beta Monoclonal antibody

CATALOG NUMBER: 60062-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GMF Beta (60062-1-Ig) by Proteintech is a Monoclonal antibody targeting GMF Beta in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig samples 60062-1-Ig targets GMF Beta in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: fetal human brain tissue, pig liver tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-87 MG cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GMFB, Glia maturation factor beta, is a nerve growth factor implicated in nervous system development. It was reported that GMF-beta promotes the phenotypic expression of glia and neurons and inhibits the proliferation of their respective tumors in culture cells. GMF-beta protein is specific to the brain where it is expressed in glial cells (mainly astrocytes) and insome neurons. Higher levels of GMFB were found in the central nervous system, except for the spinal cord, and in thymus and colon. Specification Tested Reactivity: human, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1104 Product name: Recombinant human GMFB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC005359 Sequence: MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY Predict reactive species Full Name: glia maturation factor, beta Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC005359 Gene Symbol: GMFB Gene ID (NCBI): 2764 RRID: AB_2110835 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P60983 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924