Iright
BRAND / VENDOR: Proteintech

Proteintech, 60067-1-Ig, Neuropilin 1/CD304 Monoclonal antibody

CATALOG NUMBER: 60067-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Neuropilin 1/CD304 (60067-1-Ig) by Proteintech is a Monoclonal antibody targeting Neuropilin 1/CD304 in WB, IF/ICC, ELISA applications with reactivity to human, pig, rabbit samples 60067-1-Ig targets Neuropilin 1/CD304 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, pig, rabbit samples. Tested Applications Positive WB detected in: human placenta tissue, fetal human brain tissue, human plasma, 37°C incubated human placenta tissue, pig brain tissue, HeLa cells, rabbit heart tissue, MDA-MB-231 cells, A549 cells, pig heart tissue Positive IF/ICC detected in: SH-SY5Y cells, human embronic stem cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Neuropilin-1 (NRP1) is a 130-140 kDa transmembrane glycoprotein expressed by endothelial, dendritic, and regulatory T cells, as well as several other normal cell types and malignant tumor cells. NRP1 was first identified as a semaphorin (SEMA) receptor, involved in axonal guidance in embryonic development. NRP1 was also shown to act as a receptor for vascular endothelial growth factor (VEGF) and a promoter of angiogenesis through its interaction with VEGF-A165 (and other VEGFs) and the receptor tyrosine kinase (RTK) VEGF-R2. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion. Specification Tested Reactivity: human, pig, rabbit Cited Reactivity: human, mouse, rabbit, xenopus Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0931 Product name: Recombinant human NRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC007737 Sequence: MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN Predict reactive species Full Name: neuropilin 1 Calculated Molecular Weight: 103 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC007737 Gene Symbol: Neuropilin 1 Gene ID (NCBI): 8829 RRID: AB_2150840 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14786 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924