Iright
BRAND / VENDOR: Proteintech

Proteintech, 60074-1-Ig, IFITM1-Specific Monoclonal antibody

CATALOG NUMBER: 60074-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IFITM1-Specific (60074-1-Ig) by Proteintech is a Monoclonal antibody targeting IFITM1-Specific in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 60074-1-Ig targets IFITM1-Specific in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: TF-1 cells, K-562 cells, human testis tissue, HepG2 cells, HL-60 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: K-562 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IFITM1(interferon induced transmembrane protein), also named DSPA2a and interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection. 60074-1-Ig is a mouse monoclonal antibody which specifically recognizing IFITM1 but not IFITM2 or IFITM3. Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2320 Product name: Recombinant human IFITM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC000897 Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY Predict reactive species Full Name: interferon induced transmembrane protein 1 (9-27) Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14-17 kDa GenBank Accession Number: BC000897 Gene Symbol: IFITM1 Gene ID (NCBI): 8519 RRID: AB_2233405 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P13164 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924