Proteintech, 60076-1-Ig, SULT1A1 Monoclonal antibody

Size: 20ul / 150ul The SULT1A1 (60076-1-Ig) by Proteintech is a Monoclonal antibody targeting SULT1A1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 60076-1-Ig targets SULT1A1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, human placenta tissue, human liver tissue, Jurkat cells, U2OS cells, HepG2 cells, HEK-293 cells, rat brain tissue, mouse brain tissue, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:5000 Background Information SULT1A1, also named as ST1A1, P-PST 1, ST1A3, Ts-PST, P-PST 1, STP and STP1, belongs to the sulfotransferase 1 family. It catalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. SULT1A1 is also responsible for the sulfation and activation of minoxidil. It mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4611 Product name: Recombinant human SULT1A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-295 aa of BC000923 Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Predict reactive species Full Name: sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC000923 Gene Symbol: SULT1A1 Gene ID (NCBI): 6817 RRID: AB_2197592 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P50225 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.