Iright
BRAND / VENDOR: Proteintech

Proteintech, 60123-1-Ig, CXCL16 Monoclonal antibody

CATALOG NUMBER: 60123-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CXCL16 (60123-1-Ig) by Proteintech is a Monoclonal antibody targeting CXCL16 in WB, ELISA applications with reactivity to human samples 60123-1-Ig targets CXCL16 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells, SH-SY5Y cells, Calu-3 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CXCL16 is a recently discovered cytokine belonging to the CXC chemokine family, which is synthesised in plasmacytoid dendritic cell as a transmembrane molecule. It exists in a transmembrane and soluble form. The transmembrane form of CXCL16 functions as an adhesion molecule for CXCR6-expressing cells, whereas the soluble form of CXCL16 mediates infiltration of circulating cells into sites of injury. CXCL16, has been proposed as an important pathogenic mediator in inflammatory diseases, including rheumatoid arthritis, glomerulonephritis, or prostate cancer. CXCL16 has been implicated in some forms of renal disease such as lupus nephritis and antiglomerular basement membrane nephritis. CXCL16 also plays a pivotal role in the pathogenesis of angiotensin II-induced renal injury and fibrosis through regulation of macrophage and T cell infiltration and bone marrow-derived fibroblast accumulation. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4883 Product name: Recombinant human CXCL16 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 46-225 aa of BC017588 Sequence: GNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATV Predict reactive species Full Name: chemokine (C-X-C motif) ligand 16 Calculated Molecular Weight: 273 aa, 30 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC017588 Gene Symbol: CXCL16 Gene ID (NCBI): 58191 RRID: AB_2086188 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H2A7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924