Iright
BRAND / VENDOR: Proteintech

Proteintech, 60125-1-Ig, RABEP2 Monoclonal antibody

CATALOG NUMBER: 60125-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RABEP2 (60125-1-Ig) by Proteintech is a Monoclonal antibody targeting RABEP2 in WB, IHC, ELISA applications with reactivity to human, rat, pig samples 60125-1-Ig targets RABEP2 in WB, IHC, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: HSC-T6 cells, Jurkat cells, PC-3 cells Positive IHC detected in: human prostate cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RABEP2, also named as RABPT5B, plays a role in membrane trafficking and in homotypic early endosome fusion. It has two isoforms with MW 59-63 kDa. Specification Tested Reactivity: human, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6197 Product name: Recombinant human RABEP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-299 aa of BC058900 Sequence: MAAAAPVAADDDERRRRPGAALEDSRSQEGANGEAESGELSRLRAELAGALAEMETMKAVAEVSESTKAEAVAAVQRQCQEEVASLQAILKDSISSYEAQITALKQERQQQQQDCEEKERELGRLKQLLSRAYPLDSLEKQMEKAHEDSEKLREIVLPMEKEIEELKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPLEELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPEQEETASLVSTGTLVPEGIYLPPPGYQLVPDTQWEQLQTEM Predict reactive species Full Name: rabaptin, RAB GTPase binding effector protein 2 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC058900 Gene Symbol: RABEP2 Gene ID (NCBI): 79874 RRID: AB_2284821 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9H5N1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924