Iright
BRAND / VENDOR: Proteintech

Proteintech, 60133-1-Ig, KCNIP4 Monoclonal antibody

CATALOG NUMBER: 60133-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCNIP4 (60133-1-Ig) by Proteintech is a Monoclonal antibody targeting KCNIP4 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 60133-1-Ig targets KCNIP4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, human brain tissue, rat brain tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information KCNIP4 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4863 Product name: Recombinant human KCNIP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-250 aa of BC032520 Sequence: MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI Predict reactive species Full Name: Kv channel interacting protein 4 Calculated Molecular Weight: 250 aa, 28 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC032520 Gene Symbol: KCNIP4 Gene ID (NCBI): 80333 RRID: AB_2130271 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6PIL6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924