Iright
BRAND / VENDOR: Proteintech

Proteintech, 60145-4-Ig, PAX8 Monoclonal antibody

CATALOG NUMBER: 60145-4-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PAX8 (60145-4-Ig) by Proteintech is a Monoclonal antibody targeting PAX8 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 60145-4-Ig targets PAX8 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, human thyroid gland tissue Positive IHC detected in: human ovary tumor tissue, human ovary cancer tissue, human thyroid cancer tissue, human tonsillitis tissue, mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinomas.PAX8 has 5 isoforms with calculated MW 31kd, 34kd, 41kd, 43kd and 48kd. And there is a 60kd band corresponding to the electrophoretic mobility of PAX8 (PMID:15650356). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0306 Product name: Recombinant human PAX8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC001060 Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS Predict reactive species Full Name: paired box 8 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC001060 Gene Symbol: PAX8 Gene ID (NCBI): 7849 RRID: AB_10643528 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q06710 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924