Iright
BRAND / VENDOR: Proteintech

Proteintech, 60150-2-Ig, GSTO1 Monoclonal antibody

CATALOG NUMBER: 60150-2-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSTO1 (60150-2-Ig) by Proteintech is a Monoclonal antibody targeting GSTO1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 60150-2-Ig targets GSTO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, human heart tissue, U-937 cells, Raji cells, ROS1728 cells, NIH/3T3 cells, A431 cells, HeLa cells, Jurkat cells, K-562 cells Positive IHC detected in: human oesophagus cancer tissue, human liver tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Glutathione-S-transferase omega 1 (GSTO1) belongs to a new subfamily of GSTs and is the rate limiting enzyme for biotransformation of inorganic arsenic, environmental carcinogen. Expression of GSTO1-1 was abundant in a wide range of normal tissues, particularly liver, macrophages, glial cells, and endocrine cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7199 Product name: Recombinant human GSTO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-241 aa of BC000127 Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL Predict reactive species Full Name: glutathione S-transferase omega 1 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC000127 Gene Symbol: GSTO1 Gene ID (NCBI): 9446 RRID: AB_10644447 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P78417 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924